PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009808m
Common NameCARUB_v10009808mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 315aa    MW: 34513.7 Da    PI: 8.9713
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009808mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.5e-09754345
                     SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                      W+ eE++ + +a++++  +      +W++ a++++ ++tl+++k ++q
  Carubv10009808m  7 TWSREEEKAFENAIALHCVEeditddQWTKMASMVP-TKTLEDVKKYFQ 54
                     5****************999****************.**********99 PP

2Myb_DNA-binding38.82.1e-12134178347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  Carubv10009808m 134 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 178
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.339361IPR017884SANT domain
SMARTSM007171.0E-6459IPR001005SANT/Myb domain
PfamPF002496.4E-7754IPR001005SANT/Myb domain
CDDcd001677.29E-8757No hitNo description
SuperFamilySSF466891.72E-8864IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-4857IPR009057Homeodomain-like
PROSITE profilePS5129416.873127183IPR017930Myb domain
SuperFamilySSF466897.9E-17129184IPR009057Homeodomain-like
SMARTSM007172.3E-10131181IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.5E-17131181IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.9E-11132177IPR009057Homeodomain-like
PfamPF002497.9E-11134178IPR001005SANT/Myb domain
CDDcd001671.13E-9134179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MESVVATWSR EEEKAFENAI ALHCVEEDIT DDQWTKMASM VPTKTLEDVK KYFQILLEDV  60
KAIEDGQVPL PRYHHRKGLV ADEAATSPAN RDSHSSGSSE KKPNPGTSGV SSSNGGGGRS  120
GGSRAEQERR KGIPWTEEEH RLFLLGLDKF GKGDWRSISR NFVISRTPTQ VASHAQKYFI  180
RLNSMNRDRR RSSIHDITTV NNQAPAVTGG GQQQQQVVKH RPAQPQPQPQ PQQQPHHPPT  240
MAGLGMYGGA PVGQPIIAPH DHMGSAVGTP VMLPPPMGTH HHHHHHHLGV APYALPAYPV  300
PPLPQQHPAP STMH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-128781178RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0869060.0AY086906.1 Arabidopsis thaliana clone 29302 mRNA, complete sequence.
GenBankAY5195280.0AY519528.1 Arabidopsis thaliana MYB transcription factor (At1g49010) mRNA, complete cds.
GenBankBT0248620.0BT024862.1 Arabidopsis thaliana At1g49010 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305410.10.0hypothetical protein CARUB_v10009808mg
SwissprotQ8S9H71e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0IMJ40.0R0IMJ4_9BRAS; Uncharacterized protein
STRINGAT1G49010.11e-177(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-143MYB family protein